Lineage for d4kphl2 (4kph L:108-212)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1764081Domain d4kphl2: 4kph L:108-212 [224433]
    Other proteins in same PDB: d4kphl1, d4kphm1
    automated match to d2fd6l2
    complexed with act

Details for d4kphl2

PDB Entry: 4kph (more details), 2.59 Å

PDB Description: structure of the fab fragment of n62, a protective monoclonal antibody to the nonreducing end of francisella tularensis o-antigen
PDB Compounds: (L:) N62 light chain

SCOPe Domain Sequences for d4kphl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kphl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d4kphl2:

Click to download the PDB-style file with coordinates for d4kphl2.
(The format of our PDB-style files is described here.)

Timeline for d4kphl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kphl1