SCOPe 2.08: Domain d4kphl2: 4kph L:108-212

Lineage for d4kphl2 (4kph L:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4kphl2: 4kph L:108-212 [224433]
   Other proteins in same PDB: d4kphh_, d4kphi_, d4kphl1, d4kphm1
   automated match to d2fd6l2
   complexed with act

Details for d4kphl2

PDB Entry: 4kph, 2.59 Å

PDB Description: structure of the fab fragment of n62, a protective monoclonal antibody to the nonreducing end of francisella tularensis o-antigen

PDB Compounds: (L:) N62 light chain

SCOPe Domain Sequences for d4kphl2:

Sequence; same for both SEQRES and ATOM records:

>d4kphl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4kphl2:

• d4kphl2 first appeared in SCOPe 2.03
  
• d4kphl2 appears in SCOPe 2.07