SCOPe 2.03: Domain d4kp6a_: 4kp6 A:

Lineage for d4kp6a_ (4kp6 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48550] (28 PDB entries)
   Uniprot Q07343 324-667

8. Domain d4kp6a_: 4kp6 A: [224431]
   automated match to d3d3pa_
   complexed with 1s1, edo, mg, zn

Details for d4kp6a_

PDB Entry: 4kp6, 1.5 Å

PDB Description: crystal structure of human phosphodiesterase 4b (pde4b) in complex with a [1,3,5]triazine derivative

PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d4kp6a_:

Sequence; same for both SEQRES and ATOM records:

>d4kp6a_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
nedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymm
tledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgv
snqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidm
vlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptksle
lyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadl
vqpdaqdildtlednrnwyqsmip

Timeline for d4kp6a_:

• d4kp6a_ is new in SCOPe 2.03-stable
  
• d4kp6a_ appears in SCOPe 2.04
  
• d4kp6a_ appears in the current release, SCOPe 2.08