Lineage for d1svcp2 (1svc P:43-250)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) 
Superfamily b.2.5: p53-like transcription factors [49417] (1 family) 
Family b.2.5.1: p53-like transcription factors [49418] (10 proteins) 
Protein p50 subunit of NF-kappa B (NFKB), N-terminal domain [49423] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [49424] (1 PDB entry) 
Domain d1svcp2: 1svc P:43-250 [22443]
Other proteins in same PDB: d1svcp1
Details for d1svcp2
PDB Entry: 1svc (more details), 2.6 Å
PDB Description: nfkb p50 homodimer bound to dna
SCOP Domain Sequences for d1svcp2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svcp2 b.2.5.1 (P:43-250) p50 subunit of NF-kappa B (NFKB), N-terminal domain {Human (Homo sapiens)}
pylqileqpkqrgfrfryvaegpshgglpgasseknkksypqvkicnyvgpakvivqlvt
ngknihlhahslvgkhcedgictvtagpkdmvvgfanlgilhvtkkkvfetlearmteac
irgynpgllvhpdlaylqaegggdrqlgdrekelirqaalqqtkemdlsvvrlmftaflp
dstgsftrrlepvvsdaiydskapnasn
SCOP Domain Coordinates for d1svcp2:
Click to download the PDB-style file with coordinates for d1svcp2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1svcp2:
- d1svcp2 appears in SCOP 1.57
- d1svcp2 appears in the current release, SCOPe 2.08
View in 3D
