SCOPe 2.03: Domain d4ko4s_: 4ko4 S:

Lineage for d4ko4s_ (4ko4 S:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein automated matches [190110] (5 species)
   not a true protein

7. Species Desulfomicrobium baculatum [TaxId:899] [226720] (6 PDB entries)

8. Domain d4ko4s_: 4ko4 S: [224429]
   Other proteins in same PDB: d4ko4l_, d4ko4m_
   automated match to d1cc1s_
   complexed with ca, cl, fco, gol, h2s, ni, sf4

Details for d4ko4s_

PDB Entry: 4ko4, 2 Å

PDB Description: high x-ray dose structure of anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air

PDB Compounds: (S:) Periplasmic [NiFeSe] hydrogenase small subunit

SCOPe Domain Sequences for d4ko4s_:

Sequence; same for both SEQRES and ATOM records:

>d4ko4s_ e.19.1.1 (S:) automated matches {Desulfomicrobium baculatum [TaxId: 899]}
akkapviwvqgqgctgcsvsllnavhprikeilldvislefhptvmasegemalahmyei
aekfngnffllvegaiptakegrycivgetldakghhhevtmmelirdlapkslatvavg
tcsayggipaaegnvtgsksvrdffadekiekllvnvpgcpphpdwmvgtlvaawshvln
ptehplpeldddgrpllffgdnihencpyldkydnsefaetftkpgckaelgckgpstya
dcakrrwnnginwcvenavcigcvepdfpdgkspfyvae

Timeline for d4ko4s_:

• d4ko4s_ is new in SCOPe 2.03-stable
  
• d4ko4s_ appears in SCOPe 2.04
  
• d4ko4s_ appears in the current release, SCOPe 2.08