Lineage for d4ko2s_ (4ko2 S:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1453668Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 1453669Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 1453670Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 1453700Protein automated matches [190110] (5 species)
    not a true protein
  7. 1453701Species Desulfomicrobium baculatum [TaxId:899] [226720] (6 PDB entries)
  8. 1453706Domain d4ko2s_: 4ko2 S: [224421]
    Other proteins in same PDB: d4ko2l_, d4ko2m_
    automated match to d1cc1s_
    complexed with ca, fco, gol, h2s, ni, sf4

Details for d4ko2s_

PDB Entry: 4ko2 (more details), 1.6 Å

PDB Description: low x-ray dose structure of h2-activated anaerobically purified dm. baculatum [nifese]-hydrogenase after crystallization under air
PDB Compounds: (S:) Periplasmic [NiFeSe] hydrogenase small subunit

SCOPe Domain Sequences for d4ko2s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ko2s_ e.19.1.1 (S:) automated matches {Desulfomicrobium baculatum [TaxId: 899]}
akkapviwvqgqgctgcsvsllnavhprikeilldvislefhptvmasegemalahmyei
aekfngnffllvegaiptakegrycivgetldakghhhevtmmelirdlapkslatvavg
tcsayggipaaegnvtgsksvrdffadekiekllvnvpgcpphpdwmvgtlvaawshvln
ptehplpeldddgrpllffgdnihencpyldkydnsefaetftkpgckaelgckgpstya
dcakrrwnnginwcvenavcigcvepdfpdgkspfyvae

SCOPe Domain Coordinates for d4ko2s_:

Click to download the PDB-style file with coordinates for d4ko2s_.
(The format of our PDB-style files is described here.)

Timeline for d4ko2s_: