![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins) the insertion subdomain is a 4-helical bundle |
![]() | Protein automated matches [190691] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225583] (3 PDB entries) |
![]() | Domain d4knva1: 4knv A:7-242 [224410] Other proteins in same PDB: d4knva2, d4knva3, d4knvb2, d4knvb3 automated match to d2gfha1 complexed with mg, po4 |
PDB Entry: 4knv (more details), 1.99 Å
SCOPe Domain Sequences for d4knva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4knva1 c.108.1.6 (A:7-242) automated matches {Human (Homo sapiens) [TaxId: 9606]} ravffdldntlidtagasrrgmlevikllqskyhykeeaeiicdkvqvklskecfhpynt citdlrtshweeaiqetkggaanrklaeecyflwkstrlqhmtlaedvkamltelrkevr lllltngdrqtqrekieacacqsyfdavvvggeqreekpapsifyyccnllgvqpgdcvm vgdtletdiqgglnaglkatvwinkngivplksspvphymvssvlelpallqsidc
Timeline for d4knva1: