Lineage for d1a66a_ (1a66 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2378032Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2378076Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)
  7. 2378077Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)
  8. 2378099Domain d1a66a_: 1a66 A: [22441]
    protein/DNA complex

Details for d1a66a_

PDB Entry: 1a66 (more details)

PDB Description: solution nmr structure of the core nfatc1/dna complex, 18 structures
PDB Compounds: (A:) core nfatc1

SCOPe Domain Sequences for d1a66a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a66a_ b.2.5.3 (A:) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
mkdwqlpshsgpyelrievqpkshhraryetegsrgavkasagghpivqlhgyleneplm
lqlfigtaddrllrphafyqvhritgktvsttsheailsntkvleipllpensmravidc
agilklrnsdielrkgetdigrkntrvrlvfrvhvpqpsgrtlslqvasnpiecsqrs

SCOPe Domain Coordinates for d1a66a_:

Click to download the PDB-style file with coordinates for d1a66a_.
(The format of our PDB-style files is described here.)

Timeline for d1a66a_: