SCOPe 2.06: Domain d1a66a_: 1a66 A:

Lineage for d1a66a_ (1a66 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)

8. Domain d1a66a_: 1a66 A: [22441]
   protein/DNA complex

Details for d1a66a_

PDB Entry: 1a66

PDB Description: solution nmr structure of the core nfatc1/dna complex, 18 structures

PDB Compounds: (A:) core nfatc1

SCOPe Domain Sequences for d1a66a_:

Sequence; same for both SEQRES and ATOM records:

>d1a66a_ b.2.5.3 (A:) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
mkdwqlpshsgpyelrievqpkshhraryetegsrgavkasagghpivqlhgyleneplm
lqlfigtaddrllrphafyqvhritgktvsttsheailsntkvleipllpensmravidc
agilklrnsdielrkgetdigrkntrvrlvfrvhvpqpsgrtlslqvasnpiecsqrs

Timeline for d1a66a_:

• d1a66a_ first appeared (with stable ids) in SCOP 1.55
  
• d1a66a_ appears in SCOPe 2.05
  
• d1a66a_ appears in SCOPe 2.07
  
• d1a66a_ appears in the current release, SCOPe 2.08