SCOP 1.57: Domain d1a66a_: 1a66 A:

Lineage for d1a66a_ (1a66 A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)

4. Superfamily b.2.5: p53-like transcription factors [49417] (1 family)

5. Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)

6. Protein Transcription factor NFATC, DNA-binding domain [49421] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49422] (3 PDB entries)

8. Domain d1a66a_: 1a66 A: [22441]

Details for d1a66a_

PDB Entry: 1a66

PDB Description: solution nmr structure of the core nfatc1/dna complex, 18 structures

SCOP Domain Sequences for d1a66a_:

Sequence; same for both SEQRES and ATOM records:

>d1a66a_ b.2.5.1 (A:) Transcription factor NFATC, DNA-binding domain {Human (Homo sapiens)}
mkdwqlpshsgpyelrievqpkshhraryetegsrgavkasagghpivqlhgyleneplm
lqlfigtaddrllrphafyqvhritgktvsttsheailsntkvleipllpensmravidc
agilklrnsdielrkgetdigrkntrvrlvfrvhvpqpsgrtlslqvasnpiecsqrs

Timeline for d1a66a_:

• d1a66a_ first appeared (with stable ids) in SCOP 1.55
  
• d1a66a_ appears in SCOP 1.59
  
• d1a66a_ appears in the current release, SCOPe 2.08