Lineage for d1a66a_ (1a66 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10320Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 10414Superfamily b.2.5: p53-like transcription factors [49417] (1 family) (S)
  5. 10415Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)
  6. 10464Protein Transcription factor NFATC, DNA-binding domain [49421] (1 species)
  7. 10465Species Human (Homo sapiens) [TaxId:9606] [49422] (3 PDB entries)
  8. 10467Domain d1a66a_: 1a66 A: [22441]

Details for d1a66a_

PDB Entry: 1a66 (more details)

PDB Description: solution nmr structure of the core nfatc1/dna complex, 18 structures

SCOP Domain Sequences for d1a66a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a66a_ b.2.5.1 (A:) Transcription factor NFATC, DNA-binding domain {Human (Homo sapiens)}
mkdwqlpshsgpyelrievqpkshhraryetegsrgavkasagghpivqlhgyleneplm
lqlfigtaddrllrphafyqvhritgktvsttsheailsntkvleipllpensmravidc
agilklrnsdielrkgetdigrkntrvrlvfrvhvpqpsgrtlslqvasnpiecsqrs

SCOP Domain Coordinates for d1a66a_:

Click to download the PDB-style file with coordinates for d1a66a_.
(The format of our PDB-style files is described here.)

Timeline for d1a66a_: