SCOPe 2.02: Domain d1a02n2: 1a02 N:399-576

Lineage for d1a02n2 (1a02 N:399-576)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)

6. Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)

8. Domain d1a02n2: 1a02 N:399-576 [22440]
   Other proteins in same PDB: d1a02f_, d1a02j_, d1a02n1
   protein/DNA complex

Details for d1a02n2

PDB Entry: 1a02, 2.7 Å

PDB Description: structure of the dna binding domains of nfat, fos and jun bound to dna

PDB Compounds: (N:) nuclear factor of activated t cells

SCOPe Domain Sequences for d1a02n2:

Sequence; same for both SEQRES and ATOM records:

>d1a02n2 b.2.5.3 (N:399-576) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsahe

Timeline for d1a02n2:

• d1a02n2 first appeared (with stable ids) in SCOP 1.55
  
• d1a02n2 appears in SCOPe 2.01
  
• d1a02n2 appears in SCOPe 2.03
  
• d1a02n2 appears in the current release, SCOPe 2.08