![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (7 families) ![]() |
![]() | Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins) |
![]() | Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries) |
![]() | Domain d1a02n2: 1a02 N:399-576 [22440] Other proteins in same PDB: d1a02f_, d1a02j_, d1a02n1 mutant |
PDB Entry: 1a02 (more details), 2.7 Å
SCOP Domain Sequences for d1a02n2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a02n2 b.2.5.3 (N:399-576) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsahe
Timeline for d1a02n2: