Lineage for d4klfa1 (4klf A:10-91)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272498Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 1272499Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 1272500Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 1272501Species Human (Homo sapiens) [TaxId:9606] [47805] (132 PDB entries)
    Uniprot P06746
  8. 1272509Domain d4klfa1: 4klf A:10-91 [224361]
    Other proteins in same PDB: d4klfa2, d4klfa3
    automated match to d1tv9a1
    protein/DNA complex; complexed with cl, dcp, mg, na, ppv

Details for d4klfa1

PDB Entry: 4klf (more details), 1.85 Å

PDB Description: dna polymerase beta matched reactant complex with mg2+, 20 s
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d4klfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4klfa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

SCOPe Domain Coordinates for d4klfa1:

Click to download the PDB-style file with coordinates for d4klfa1.
(The format of our PDB-style files is described here.)

Timeline for d4klfa1: