SCOPe 2.03: Domain d4klea1: 4kle A:10-91

Lineage for d4klea1 (4kle A:10-91)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (132 PDB entries)
   Uniprot P06746

8. Domain d4klea1: 4kle A:10-91 [224358]
   Other proteins in same PDB: d4klea2, d4klea3
   automated match to d1tv9a1
   protein/DNA complex; complexed with dcp, mg, ppv

Details for d4klea1

PDB Entry: 4kle, 1.97 Å

PDB Description: dna polymerase beta matched reactant complex with mg2+, 10 s

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d4klea1:

Sequence; same for both SEQRES and ATOM records:

>d4klea1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

Timeline for d4klea1:

• d4klea1 is new in SCOPe 2.03-stable
  
• d4klea1 appears in SCOPe 2.04
  
• d4klea1 appears in the current release, SCOPe 2.08