SCOPe 2.05: Domain d4kl7d_: 4kl7 D:

Lineage for d4kl7d_ (4kl7 D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.8: RPF-like [159824] (2 proteins)
   Pfam PF06737; Transglycosylase-like domain

6. Protein automated matches [193952] (1 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [193953] (3 PDB entries)

8. Domain d4kl7d_: 4kl7 D: [224350]
   automated match to d4emnd_
   complexed with so4

Details for d4kl7d_

PDB Entry: 4kl7, 1.45 Å

PDB Description: Crystal structure of the catalytic domain of RpfB from Mycobacterium tuberculosis

PDB Compounds: (D:) Resuscitation-promoting factor rpfB

SCOPe Domain Sequences for d4kl7d_:

Sequence; same for both SEQRES and ATOM records:

>d4kl7d_ d.2.1.8 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar

Timeline for d4kl7d_:

• d4kl7d_ first appeared in SCOPe 2.03
  
• d4kl7d_ appears in SCOPe 2.04
  
• d4kl7d_ appears in SCOPe 2.06
  
• d4kl7d_ appears in the current release, SCOPe 2.08