Lineage for d4kl7d_ (4kl7 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926450Family d.2.1.8: RPF-like [159824] (2 proteins)
    Pfam PF06737; Transglycosylase-like domain
  6. 2926454Protein automated matches [193952] (1 species)
    not a true protein
  7. 2926455Species Mycobacterium tuberculosis [TaxId:1773] [193953] (3 PDB entries)
  8. 2926463Domain d4kl7d_: 4kl7 D: [224350]
    automated match to d4emnd_
    complexed with so4

Details for d4kl7d_

PDB Entry: 4kl7 (more details), 1.45 Å

PDB Description: Crystal structure of the catalytic domain of RpfB from Mycobacterium tuberculosis
PDB Compounds: (D:) Resuscitation-promoting factor rpfB

SCOPe Domain Sequences for d4kl7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kl7d_ d.2.1.8 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar

SCOPe Domain Coordinates for d4kl7d_:

Click to download the PDB-style file with coordinates for d4kl7d_.
(The format of our PDB-style files is described here.)

Timeline for d4kl7d_: