Lineage for d4kl7c_ (4kl7 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533617Family d.2.1.8: RPF-like [159824] (2 proteins)
    Pfam PF06737; Transglycosylase-like domain
  6. 2533621Protein automated matches [193952] (1 species)
    not a true protein
  7. 2533622Species Mycobacterium tuberculosis [TaxId:1773] [193953] (3 PDB entries)
  8. 2533633Domain d4kl7c_: 4kl7 C: [224349]
    automated match to d4emnd_
    complexed with so4

Details for d4kl7c_

PDB Entry: 4kl7 (more details), 1.45 Å

PDB Description: Crystal structure of the catalytic domain of RpfB from Mycobacterium tuberculosis
PDB Compounds: (C:) Resuscitation-promoting factor rpfB

SCOPe Domain Sequences for d4kl7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kl7c_ d.2.1.8 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar

SCOPe Domain Coordinates for d4kl7c_:

Click to download the PDB-style file with coordinates for d4kl7c_.
(The format of our PDB-style files is described here.)

Timeline for d4kl7c_: