Lineage for d4kl7b_ (4kl7 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1397247Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1397248Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1398863Family d.2.1.8: RPF-like [159824] (2 proteins)
    Pfam PF06737; Transglycosylase-like domain
  6. 1398867Protein automated matches [193952] (1 species)
    not a true protein
  7. 1398868Species Mycobacterium tuberculosis [TaxId:1773] [193953] (3 PDB entries)
  8. 1398878Domain d4kl7b_: 4kl7 B: [224348]
    automated match to d4emnd_
    complexed with so4

Details for d4kl7b_

PDB Entry: 4kl7 (more details), 1.45 Å

PDB Description: Crystal structure of the catalytic domain of RpfB from Mycobacterium tuberculosis
PDB Compounds: (B:) Resuscitation-promoting factor rpfB

SCOPe Domain Sequences for d4kl7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kl7b_ d.2.1.8 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
siwdaiagceaggnwaintgngyyggvqfdqgtweangglryapradlatreeqiavaev
trlrqgwgawpvcaaragar

SCOPe Domain Coordinates for d4kl7b_:

Click to download the PDB-style file with coordinates for d4kl7b_.
(The format of our PDB-style files is described here.)

Timeline for d4kl7b_: