Lineage for d4kkmb_ (4kkm B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2011118Species Zymomonas mobilis [TaxId:264203] [226672] (1 PDB entry)
  8. 2011120Domain d4kkmb_: 4kkm B: [224345]
    automated match to d1rqjb_
    complexed with act, ca, gol

Details for d4kkmb_

PDB Entry: 4kkm (more details), 1.9 Å

PDB Description: crystal structure of a fpp/gfpp synthase (target efi-501952) from zymomonas mobilis, apo structure
PDB Compounds: (B:) Polyprenyl synthetase

SCOPe Domain Sequences for d4kkmb_:

Sequence, based on SEQRES records: (download)

>d4kkmb_ a.128.1.0 (B:) automated matches {Zymomonas mobilis [TaxId: 264203]}
mavnlktmmeqvaqdidrlfaeqlpvpedprrrlveamryaaigggkrlrpllvvatcal
fnvdreaalrvgmaiecihvyslihddmpcmdnddlrrgkptvhkafddasavlsgdalq
alafeilseekihtdphvrleliqalaiasgkdgmvggqaidlaaetstvpfdlptitrl
qqlktgalfgfcleagaimgrqnkdirdrlkayardiglafqiaddlidaegdeavagka
vgkdaaagkatflsllglekarsqaqalvdqaiahlsvfgseadylrsiaryiv

Sequence, based on observed residues (ATOM records): (download)

>d4kkmb_ a.128.1.0 (B:) automated matches {Zymomonas mobilis [TaxId: 264203]}
mavnlktmmeqvaqdidrlfaeqlpvpedprrrlveamryaaigggkrlrpllvvatcal
fnvdreaalrvgmaiecihvyslihddmpcmdnddlrrgkptvhkafddasavlsgdalq
alafeilseekihtdphvrleliqalaiasgkdgmvggqaidlaaetstvpfdlptitrl
qqlktgalfgfcleagaimgrqnkdirdrlkayardiglafqiaddlidaegdgkatfls
llglekarsqaqalvdqaiahlsvfgseadylrsiaryiv

SCOPe Domain Coordinates for d4kkmb_:

Click to download the PDB-style file with coordinates for d4kkmb_.
(The format of our PDB-style files is described here.)

Timeline for d4kkmb_: