Lineage for d4kkla_ (4kkl A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253242Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2253243Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2253244Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2253292Protein automated matches [226846] (4 species)
    not a true protein
  7. 2253293Species Escherichia coli K-12 [TaxId:83333] [224947] (13 PDB entries)
  8. 2253308Domain d4kkla_: 4kkl A: [224334]
    Other proteins in same PDB: d4kklc1, d4kklc2, d4kkld1, d4kkld2, d4kkle1, d4kkle2, d4kklf1, d4kklf2
    automated match to d1kpla_
    complexed with f; mutant

Details for d4kkla_

PDB Entry: 4kkl (more details), 2.85 Å

PDB Description: Structure of the E148A mutant of CLC-ec1 delta NC construct in 100mM fluoride
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d4kkla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkla_ f.20.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeaeq

SCOPe Domain Coordinates for d4kkla_:

Click to download the PDB-style file with coordinates for d4kkla_.
(The format of our PDB-style files is described here.)

Timeline for d4kkla_: