Lineage for d4kk8e1 (4kk8 E:2-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740087Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (62 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 2740140Domain d4kk8e1: 4kk8 E:2-121 [224330]
    Other proteins in same PDB: d4kk8a_, d4kk8b_, d4kk8c2, d4kk8d1, d4kk8d2, d4kk8e2, d4kk8f1, d4kk8f2
    automated match to d1otsc1
    complexed with f; mutant

Details for d4kk8e1

PDB Entry: 4kk8 (more details), 2.86 Å

PDB Description: Structure of the E148Q mutant of CLC-ec1 deltaNC construct in 100mM fluoride
PDB Compounds: (E:) Fab, heavy chain

SCOPe Domain Sequences for d4kk8e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kk8e1 b.1.1.1 (E:2-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss

SCOPe Domain Coordinates for d4kk8e1:

Click to download the PDB-style file with coordinates for d4kk8e1.
(The format of our PDB-style files is described here.)

Timeline for d4kk8e1: