Lineage for d1ycsa_ (1ycs A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040931Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2040932Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2040933Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2040934Species Human (Homo sapiens) [TaxId:9606] [49420] (40 PDB entries)
  8. 2040999Domain d1ycsa_: 1ycs A: [22433]
    Other proteins in same PDB: d1ycsb1, d1ycsb2
    complexed with zn

Details for d1ycsa_

PDB Entry: 1ycs (more details), 2.2 Å

PDB Description: p53-53bp2 complex
PDB Compounds: (A:) p53

SCOPe Domain Sequences for d1ycsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycsa_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
vpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgtr
vramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsv
vvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvca
cpgrdrrteee

SCOPe Domain Coordinates for d1ycsa_:

Click to download the PDB-style file with coordinates for d1ycsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ycsa_: