Lineage for d1ycsa_ (1ycs A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55312Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 55415Superfamily b.2.5: p53-like transcription factors [49417] (1 family) (S)
  5. 55416Family b.2.5.1: p53-like transcription factors [49418] (10 proteins)
  6. 55449Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 55450Species Human (Homo sapiens) [TaxId:9606] [49420] (3 PDB entries)
  8. 55451Domain d1ycsa_: 1ycs A: [22433]
    Other proteins in same PDB: d1ycsb1, d1ycsb2

Details for d1ycsa_

PDB Entry: 1ycs (more details), 2.2 Å

PDB Description: p53-53bp2 complex

SCOP Domain Sequences for d1ycsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ycsa_ b.2.5.1 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens)}
vpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgtr
vramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhsv
vvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvca
cpgrdrrteee

SCOP Domain Coordinates for d1ycsa_:

Click to download the PDB-style file with coordinates for d1ycsa_.
(The format of our PDB-style files is described here.)

Timeline for d1ycsa_: