Lineage for d4kk8d2 (4kk8 D:107-211)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1761687Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1761919Species Mouse (Mus musculus) [TaxId:10090] [88567] (346 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 1762279Domain d4kk8d2: 4kk8 D:107-211 [224329]
    Other proteins in same PDB: d4kk8a_, d4kk8b_, d4kk8c1, d4kk8c2, d4kk8d1, d4kk8e1, d4kk8e2, d4kk8f1
    automated match to d1otsd2
    complexed with f; mutant

Details for d4kk8d2

PDB Entry: 4kk8 (more details), 2.86 Å

PDB Description: Structure of the E148Q mutant of CLC-ec1 deltaNC construct in 100mM fluoride
PDB Compounds: (D:) Fab, light chain

SCOPe Domain Sequences for d4kk8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kk8d2 b.1.1.2 (D:107-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOPe Domain Coordinates for d4kk8d2:

Click to download the PDB-style file with coordinates for d4kk8d2.
(The format of our PDB-style files is described here.)

Timeline for d4kk8d2: