Lineage for d4kk8b_ (4kk8 B:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697321Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 1697322Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 1697323Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 1697371Protein automated matches [226846] (4 species)
    not a true protein
  7. 1697372Species Escherichia coli K-12 [TaxId:83333] [224947] (13 PDB entries)
  8. 1697378Domain d4kk8b_: 4kk8 B: [224325]
    Other proteins in same PDB: d4kk8c1, d4kk8c2, d4kk8d1, d4kk8d2, d4kk8e1, d4kk8e2, d4kk8f1, d4kk8f2
    automated match to d1kpla_
    complexed with f; mutant

Details for d4kk8b_

PDB Entry: 4kk8 (more details), 2.86 Å

PDB Description: Structure of the E148Q mutant of CLC-ec1 deltaNC construct in 100mM fluoride
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d4kk8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kk8b_ f.20.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgrqgptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeae

SCOPe Domain Coordinates for d4kk8b_:

Click to download the PDB-style file with coordinates for d4kk8b_.
(The format of our PDB-style files is described here.)

Timeline for d4kk8b_: