Lineage for d4kjyd_ (4kjy D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2355566Domain d4kjyd_: 4kjy D: [224321]
    automated match to d2jjwa_
    complexed with nag, so4

Details for d4kjyd_

PDB Entry: 4kjy (more details), 1.93 Å

PDB Description: Complex of high-affinity SIRP alpha variant FD6 with CD47
PDB Compounds: (D:) High-affinity SIRPa variant FD6

SCOPe Domain Sequences for d4kjyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kjyd_ b.1.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eevqiiqpdksvsvaagesailhctitslfpvgpiqwfrgagparvliynqrqgpfprvt
tisettrrenmdfsisisnitpadagtyycikfrkgspdtefksgagtelsvrakp

SCOPe Domain Coordinates for d4kjyd_:

Click to download the PDB-style file with coordinates for d4kjyd_.
(The format of our PDB-style files is described here.)

Timeline for d4kjyd_: