SCOPe 2.03: Domain d4kjyb_: 4kjy B:

Lineage for d4kjyb_ (4kjy B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d4kjyb_: 4kjy B: [224320]
   automated match to d2jjwa_
   complexed with nag, so4

Details for d4kjyb_

PDB Entry: 4kjy, 1.93 Å

PDB Description: complex of high-affinity sirp alpha variant fd6 with cd47

PDB Compounds: (B:) High-affinity SIRPa variant FD6

SCOPe Domain Sequences for d4kjyb_:

Sequence; same for both SEQRES and ATOM records:

>d4kjyb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eeevqiiqpdksvsvaagesailhctitslfpvgpiqwfrgagparvliynqrqgpfprv
ttisettrrenmdfsisisnitpadagtyycikfrkgspdtefksgagtelsvr

Timeline for d4kjyb_:

• d4kjyb_ is new in SCOPe 2.03-stable
  
• d4kjyb_ appears in SCOPe 2.04
  
• d4kjyb_ appears in the current release, SCOPe 2.08