Lineage for d1ayob_ (1ayo B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766890Superfamily b.1.29: Macroglobulin [254121] (9 families) (S)
    C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations
  5. 2766891Family b.1.29.1: Alpha-macroglobulin receptor domain [254148] (4 proteins)
    Pfam PF07677
  6. 2766896Protein alpha-2-macroglobulin [254336] (2 species)
  7. 2766897Species Cow (Bos taurus) [TaxId:9913] [254767] (1 PDB entry)
  8. 2766899Domain d1ayob_: 1ayo B: [22432]
    complexed with ca

Details for d1ayob_

PDB Entry: 1ayo (more details), 1.9 Å

PDB Description: receptor binding domain of bovine alpha-2-macroglobulin
PDB Compounds: (B:) alpha-2-macroglobulin

SCOPe Domain Sequences for d1ayob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayob_ b.1.29.1 (B:) alpha-2-macroglobulin {Cow (Bos taurus) [TaxId: 9913]}
efpfalevqtlpqtcdgpkahtsfqislsvsyigsrpasnmaivdvkmvsgfiplkptvk
mlersnvsrtevsnnhvliyldkvtnetltltftvlqdipvrdlkpaivkvydyyetdef
avaeysapcs

SCOPe Domain Coordinates for d1ayob_:

Click to download the PDB-style file with coordinates for d1ayob_.
(The format of our PDB-style files is described here.)

Timeline for d1ayob_: