Lineage for d4kjqf1 (4kjq F:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2741215Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (43 PDB entries)
    Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1
  8. 2741256Domain d4kjqf1: 4kjq F:1-106 [224318]
    Other proteins in same PDB: d4kjqa_, d4kjqb_, d4kjqc1, d4kjqc2, d4kjqd2, d4kjqe1, d4kjqe2, d4kjqf2
    automated match to d1otsd1
    complexed with f

Details for d4kjqf1

PDB Entry: 4kjq (more details), 2.88 Å

PDB Description: structure of the clc-ec1 deltanc construct in 100mm fluoride
PDB Compounds: (F:) Fab, light chain

SCOPe Domain Sequences for d4kjqf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kjqf1 b.1.1.1 (F:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

SCOPe Domain Coordinates for d4kjqf1:

Click to download the PDB-style file with coordinates for d4kjqf1.
(The format of our PDB-style files is described here.)

Timeline for d4kjqf1: