Lineage for d4kjqe1 (4kjq E:2-121)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1287992Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 1288043Domain d4kjqe1: 4kjq E:2-121 [224316]
    Other proteins in same PDB: d4kjqa_, d4kjqb_, d4kjqc2, d4kjqd1, d4kjqd2, d4kjqe2, d4kjqf1, d4kjqf2
    automated match to d1otsc1
    complexed with f

Details for d4kjqe1

PDB Entry: 4kjq (more details), 2.88 Å

PDB Description: structure of the clc-ec1 deltanc construct in 100mm fluoride
PDB Compounds: (E:) Fab, heavy chain

SCOPe Domain Sequences for d4kjqe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kjqe1 b.1.1.1 (E:2-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss

SCOPe Domain Coordinates for d4kjqe1:

Click to download the PDB-style file with coordinates for d4kjqe1.
(The format of our PDB-style files is described here.)

Timeline for d4kjqe1: