![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries) Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10 |
![]() | Domain d4kjqc1: 4kjq C:2-121 [224312] Other proteins in same PDB: d4kjqa_, d4kjqb_, d4kjqc2, d4kjqd1, d4kjqd2, d4kjqe2, d4kjqf1, d4kjqf2 automated match to d1otsc1 complexed with f |
PDB Entry: 4kjq (more details), 2.88 Å
SCOPe Domain Sequences for d4kjqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kjqc1 b.1.1.1 (C:2-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
Timeline for d4kjqc1: