Lineage for d4kjqb_ (4kjq B:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456404Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 1456405Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 1456406Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 1456454Protein automated matches [226846] (1 species)
    not a true protein
  7. 1456455Species Escherichia coli [TaxId:83333] [224947] (5 PDB entries)
  8. 1456461Domain d4kjqb_: 4kjq B: [224311]
    Other proteins in same PDB: d4kjqc1, d4kjqc2, d4kjqd1, d4kjqd2, d4kjqe1, d4kjqe2, d4kjqf1, d4kjqf2
    automated match to d1kpla_
    complexed with f

Details for d4kjqb_

PDB Entry: 4kjq (more details), 2.88 Å

PDB Description: structure of the clc-ec1 deltanc construct in 100mm fluoride
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d4kjqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kjqb_ f.20.1.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOPe Domain Coordinates for d4kjqb_:

Click to download the PDB-style file with coordinates for d4kjqb_.
(The format of our PDB-style files is described here.)

Timeline for d4kjqb_: