Lineage for d4kjqa_ (4kjq A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253242Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2253243Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2253244Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2253292Protein automated matches [226846] (4 species)
    not a true protein
  7. 2253293Species Escherichia coli K-12 [TaxId:83333] [224947] (13 PDB entries)
  8. 2253300Domain d4kjqa_: 4kjq A: [224310]
    Other proteins in same PDB: d4kjqc1, d4kjqc2, d4kjqd1, d4kjqd2, d4kjqe1, d4kjqe2, d4kjqf1, d4kjqf2
    automated match to d1kpla_
    complexed with f

Details for d4kjqa_

PDB Entry: 4kjq (more details), 2.88 Å

PDB Description: structure of the clc-ec1 deltanc construct in 100mm fluoride
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d4kjqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kjqa_ f.20.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeaeq

SCOPe Domain Coordinates for d4kjqa_:

Click to download the PDB-style file with coordinates for d4kjqa_.
(The format of our PDB-style files is described here.)

Timeline for d4kjqa_: