Lineage for d1ayoa_ (1ayo A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 161785Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 161908Superfamily b.2.4: Alpha-macroglobulin receptor domain [49410] (1 family) (S)
  5. 161909Family b.2.4.1: Alpha-macroglobulin receptor domain [49411] (2 proteins)
  6. 161914Protein alpha-2-macroglobulin [49414] (2 species)
  7. 161915Species Cow (Bos taurus) [TaxId:9913] [49416] (1 PDB entry)
  8. 161916Domain d1ayoa_: 1ayo A: [22431]

Details for d1ayoa_

PDB Entry: 1ayo (more details), 1.9 Å

PDB Description: receptor binding domain of bovine alpha-2-macroglobulin

SCOP Domain Sequences for d1ayoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ayoa_ b.2.4.1 (A:) alpha-2-macroglobulin {Cow (Bos taurus)}
efpfalevqtlpqtcdgpkahtsfqislsvsyigsrpasnmaivdvkmvsgfiplkptvk
mlersnvsrtevsnnhvliyldkvtnetltltftvlqdipvrdlkpaivkvydyyetdef
avaeysapcs

SCOP Domain Coordinates for d1ayoa_:

Click to download the PDB-style file with coordinates for d1ayoa_.
(The format of our PDB-style files is described here.)

Timeline for d1ayoa_: