SCOPe 2.08: Domain d1ayoa_: 1ayo A:

Lineage for d1ayoa_ (1ayo A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.29: Macroglobulin [254121] (9 families)
   C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations

5. Family b.1.29.1: Alpha-macroglobulin receptor domain [254148] (4 proteins)
   Pfam PF07677

6. Protein alpha-2-macroglobulin [254336] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [254767] (1 PDB entry)

8. Domain d1ayoa_: 1ayo A: [22431]
   complexed with ca

Details for d1ayoa_

PDB Entry: 1ayo, 1.9 Å

PDB Description: receptor binding domain of bovine alpha-2-macroglobulin

PDB Compounds: (A:) alpha-2-macroglobulin

SCOPe Domain Sequences for d1ayoa_:

Sequence; same for both SEQRES and ATOM records:

>d1ayoa_ b.1.29.1 (A:) alpha-2-macroglobulin {Cow (Bos taurus) [TaxId: 9913]}
efpfalevqtlpqtcdgpkahtsfqislsvsyigsrpasnmaivdvkmvsgfiplkptvk
mlersnvsrtevsnnhvliyldkvtnetltltftvlqdipvrdlkpaivkvydyyetdef
avaeysapcs

Timeline for d1ayoa_:

• d1ayoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ayoa_ appears in SCOPe 2.07