Lineage for d4kjmb1 (4kjm B:4-72)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2697104Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 proteins)
    Pfam PF01468; also includes FIVAR module, Pfam PF07554
  6. 2697105Protein Ebh protein [116850] (1 species)
  7. 2697106Species Staphylococcus aureus [TaxId:1280] [116851] (2 PDB entries)
    Uniprot Q8NWQ6 3912-4037
  8. 2697113Domain d4kjmb1: 4kjm B:4-72 [224308]
    Other proteins in same PDB: d4kjma3, d4kjmb3
    complexed with act, cl, na, zn

Details for d4kjmb1

PDB Entry: 4kjm (more details), 2 Å

PDB Description: crystal structure of the staphylococcus aureus protein (np_646141.1, domain 3912-4037) similar to streptococcal adhesins emb and ebha/ebhb
PDB Compounds: (B:) Extracellular matrix-binding protein ebh

SCOPe Domain Sequences for d4kjmb1:

Sequence, based on SEQRES records: (download)

>d4kjmb1 a.8.1.2 (B:4-72) Ebh protein {Staphylococcus aureus [TaxId: 1280]}
mgnlqtaindksgtlasqnfldadeqkrnaynqavsaaetilnkqtgpntaktaveqaln
nvnnakhal

Sequence, based on observed residues (ATOM records): (download)

>d4kjmb1 a.8.1.2 (B:4-72) Ebh protein {Staphylococcus aureus [TaxId: 1280]}
mgnlqtaindksgtlasqnfldadeqkrnaynqavsaaetilaktaveqalnnvnnakha
l

SCOPe Domain Coordinates for d4kjmb1:

Click to download the PDB-style file with coordinates for d4kjmb1.
(The format of our PDB-style files is described here.)

Timeline for d4kjmb1: