Lineage for d1bv8a_ (1bv8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766890Superfamily b.1.29: Macroglobulin [254121] (9 families) (S)
    C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations
  5. 2766891Family b.1.29.1: Alpha-macroglobulin receptor domain [254148] (4 proteins)
    Pfam PF07677
  6. 2766896Protein alpha-2-macroglobulin [254336] (2 species)
  7. 2766900Species Human (Homo sapiens) [TaxId:9606] [254768] (1 PDB entry)
  8. 2766901Domain d1bv8a_: 1bv8 A: [22430]

Details for d1bv8a_

PDB Entry: 1bv8 (more details)

PDB Description: receptor domain from alpha-2-macroglobulin
PDB Compounds: (A:) alpha-2-macroglobulin

SCOPe Domain Sequences for d1bv8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bv8a_ b.1.29.1 (A:) alpha-2-macroglobulin {Human (Homo sapiens) [TaxId: 9606]}
eefpfalgvqtlpqtcdepkahtsfqislsvsytgsrsasnmaivdvkmvsgfiplkptv
kmlersnhvsrtevssnhvliyldkvsnqtlslfftvlqdvpvrdlkpaivkvydyyetd
efaiaeynapcskdlgna

SCOPe Domain Coordinates for d1bv8a_:

Click to download the PDB-style file with coordinates for d1bv8a_.
(The format of our PDB-style files is described here.)

Timeline for d1bv8a_: