Lineage for d4kgqa_ (4kgq A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041369Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2041370Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2041661Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2041662Protein automated matches [190873] (4 species)
    not a true protein
  7. 2041663Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2041690Domain d4kgqa_: 4kgq A: [224294]
    automated match to d1tnfa_
    complexed with mg; mutant

Details for d4kgqa_

PDB Entry: 4kgq (more details), 2.27 Å

PDB Description: Crystal structure of a human light loop mutant in complex with dcr3
PDB Compounds: (A:) Tumor necrosis factor ligand superfamily member 14

SCOPe Domain Sequences for d4kgqa_:

Sequence, based on SEQRES records: (download)

>d4kgqa_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
vgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhlea
geevvvrvlderlvdytkedrsyfgafmv

Sequence, based on observed residues (ATOM records): (download)

>d4kgqa_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
vgcastithglykrtprypeelellvsqqspcgrvwwdssflggvvhleageevvvrvld
erlvdytkedrsyfgafmv

SCOPe Domain Coordinates for d4kgqa_:

Click to download the PDB-style file with coordinates for d4kgqa_.
(The format of our PDB-style files is described here.)

Timeline for d4kgqa_: