SCOPe 2.04: Domain d4kgic2: 4kgi C:81-200

Lineage for d4kgic2 (4kgi C:81-200)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (10 species)
   not a true protein

7. Species Shigella flexneri [TaxId:198215] [226693] (1 PDB entry)

8. Domain d4kgic2: 4kgi C:81-200 [224291]
   Other proteins in same PDB: d4kgia1, d4kgib1, d4kgic1, d4kgid1
   automated match to d1n2aa1
   complexed with gsh

Details for d4kgic2

PDB Entry: 4kgi, 1.6 Å

PDB Description: Crystal structure of a glutathione transferase family member from Shigella flexneri, target EFI-507258, bound GSH, TEV-his-tag linker in active site

PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d4kgic2:

Sequence; same for both SEQRES and ATOM records:

>d4kgic2 a.45.1.1 (C:81-200) automated matches {Shigella flexneri [TaxId: 198215]}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqldkklqyvneal
kdehwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaegl

Timeline for d4kgic2:

• d4kgic2 first appeared in SCOPe 2.03
  
• d4kgic2 appears in SCOPe 2.05
  
• d4kgic2 appears in the current release, SCOPe 2.08