Lineage for d1edyb_ (1edy B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300955Superfamily b.2.4: Alpha-macroglobulin receptor domain [49410] (1 family) (S)
  5. 1300956Family b.2.4.1: Alpha-macroglobulin receptor domain [49411] (2 proteins)
  6. 1300957Protein alpha-1-macroglobulin [49412] (1 species)
  7. 1300958Species Norway rat (Rattus norvegicus) [TaxId:10116] [49413] (1 PDB entry)
  8. 1300960Domain d1edyb_: 1edy B: [22429]

Details for d1edyb_

PDB Entry: 1edy (more details), 2.3 Å

PDB Description: crystal structure of rat alpha 1-macroglobulin receptor binding domain
PDB Compounds: (B:) alpha 1-macroglobulin

SCOPe Domain Sequences for d1edyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edyb_ b.2.4.1 (B:) alpha-1-macroglobulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk
klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde
faieeysapf

SCOPe Domain Coordinates for d1edyb_:

Click to download the PDB-style file with coordinates for d1edyb_.
(The format of our PDB-style files is described here.)

Timeline for d1edyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1edya_