![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.4: Alpha-macroglobulin receptor domain [49410] (1 family) ![]() |
![]() | Family b.2.4.1: Alpha-macroglobulin receptor domain [49411] (2 proteins) |
![]() | Protein alpha-1-macroglobulin [49412] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [49413] (1 PDB entry) |
![]() | Domain d1edyb_: 1edy B: [22429] |
PDB Entry: 1edy (more details), 2.3 Å
SCOPe Domain Sequences for d1edyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1edyb_ b.2.4.1 (B:) alpha-1-macroglobulin {Norway rat (Rattus norvegicus) [TaxId: 10116]} eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde faieeysapf
Timeline for d1edyb_: