Lineage for d1edyb_ (1edy B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 223643Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 223772Superfamily b.2.4: Alpha-macroglobulin receptor domain [49410] (1 family) (S)
  5. 223773Family b.2.4.1: Alpha-macroglobulin receptor domain [49411] (2 proteins)
  6. 223774Protein alpha-1-macroglobulin [49412] (1 species)
  7. 223775Species Rat (Rattus norvegicus) [TaxId:10116] [49413] (1 PDB entry)
  8. 223777Domain d1edyb_: 1edy B: [22429]

Details for d1edyb_

PDB Entry: 1edy (more details), 2.3 Å

PDB Description: crystal structure of rat alpha 1-macroglobulin receptor binding domain

SCOP Domain Sequences for d1edyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edyb_ b.2.4.1 (B:) alpha-1-macroglobulin {Rat (Rattus norvegicus)}
eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk
klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde
faieeysapf

SCOP Domain Coordinates for d1edyb_:

Click to download the PDB-style file with coordinates for d1edyb_.
(The format of our PDB-style files is described here.)

Timeline for d1edyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1edya_