Lineage for d1edyb_ (1edy B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) 
Superfamily b.2.4: Alpha-macroglobulin receptor domain [49410] (1 family) 
Family b.2.4.1: Alpha-macroglobulin receptor domain [49411] (2 proteins) 
Protein alpha-1-macroglobulin [49412] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [49413] (1 PDB entry) 
Domain d1edyb_: 1edy B: [22429]
Details for d1edyb_
PDB Entry: 1edy (more details), 2.3 Å
PDB Description: crystal structure of rat alpha 1-macroglobulin receptor binding domain
SCOP Domain Sequences for d1edyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1edyb_ b.2.4.1 (B:) alpha-1-macroglobulin {Rat (Rattus norvegicus)}
eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk
klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde
faieeysapf
SCOP Domain Coordinates for d1edyb_:
Click to download the PDB-style file with coordinates for d1edyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1edyb_:
- d1edyb_ appears in SCOP 1.57
- d1edyb_ appears in the current release, SCOPe 2.08
View in 3D
