SCOPe 2.07: Domain d4kfba2: 4kfb A:430-554

Lineage for d4kfba2 (4kfb A:430-554)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (19 PDB entries)

8. Domain d4kfba2: 4kfb A:430-554 [224284]
   Other proteins in same PDB: d4kfba1, d4kfba3, d4kfbb_
   automated match to d1bqna1
   protein/DNA complex; protein/RNA complex; complexed with 1qp, dms, t27

Details for d4kfba2

PDB Entry: 4kfb, 1.85 Å

PDB Description: hiv-1 reverse transcriptase with bound fragment at nnrti adjacent site

PDB Compounds: (A:) reverse transcriptase/ribonuclease h, exoribonuclea p66 rt

SCOPe Domain Sequences for d4kfba2:

Sequence; same for both SEQRES and ATOM records:

>d4kfba2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d4kfba2:

• d4kfba2 first appeared in SCOPe 2.03
  
• d4kfba2 appears in SCOPe 2.06
  
• d4kfba2 appears in the current release, SCOPe 2.08