Lineage for d4kf3b_ (4kf3 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733318Species Bothrops moojeni [TaxId:98334] [188126] (13 PDB entries)
  8. 2733330Domain d4kf3b_: 4kf3 B: [224282]
    automated match to d1xxsa_
    complexed with ipa, pe4

Details for d4kf3b_

PDB Entry: 4kf3 (more details), 1.92 Å

PDB Description: Crystal Structure of Myotoxin II (MjTX-II), a myotoxic Lys49-phospholipase A2 from Bothrops moojeni.
PDB Compounds: (B:) Basic phospholipase A2 homolog 2

SCOPe Domain Sequences for d4kf3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kf3b_ a.133.1.2 (B:) automated matches {Bothrops moojeni [TaxId: 98334]}
slfelgkmilqetgknpaksygvygcncgvggrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenldtynkkyrynylkpfckkad
pc

SCOPe Domain Coordinates for d4kf3b_:

Click to download the PDB-style file with coordinates for d4kf3b_.
(The format of our PDB-style files is described here.)

Timeline for d4kf3b_: