Lineage for d1edya_ (1edy A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 161785Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 161908Superfamily b.2.4: Alpha-macroglobulin receptor domain [49410] (1 family) (S)
  5. 161909Family b.2.4.1: Alpha-macroglobulin receptor domain [49411] (2 proteins)
  6. 161910Protein alpha-1-macroglobulin [49412] (1 species)
  7. 161911Species Rat (Rattus norvegicus) [TaxId:10116] [49413] (1 PDB entry)
  8. 161912Domain d1edya_: 1edy A: [22428]

Details for d1edya_

PDB Entry: 1edy (more details), 2.3 Å

PDB Description: crystal structure of rat alpha 1-macroglobulin receptor binding domain

SCOP Domain Sequences for d1edya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edya_ b.2.4.1 (A:) alpha-1-macroglobulin {Rat (Rattus norvegicus)}
eapftlkvntlplnfdkaehhrkfqihinvsyigerpnsnmvivdvkmvsgfipvkpsvk
klqdqsniqrtevntnhvliyiekltnqtmgfsfaveqdipvknlkpapvkvydyyetde
faieeysapfssds

SCOP Domain Coordinates for d1edya_:

Click to download the PDB-style file with coordinates for d1edya_.
(The format of our PDB-style files is described here.)

Timeline for d1edya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1edyb_