Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (6 families) |
Family b.2.3.2: Pilus subunits [49405] (8 proteins) |
Protein PapK pilus subunit [49408] (1 species) similar to C-terminal domain of FimH |
Species Escherichia coli [TaxId:562] [49409] (1 PDB entry) |
Domain d1pdkb_: 1pdk B: [22427] Other proteins in same PDB: d1pdka1, d1pdka2 |
PDB Entry: 1pdk (more details), 2.4 Å
SCOP Domain Sequences for d1pdkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdkb_ b.2.3.2 (B:) PapK pilus subunit {Escherichia coli [TaxId: 562]} lldrpchvsgdslnkhvvfktrasrdfwyppgrsptesfvirlenchatavgkivtltfk gteeaalpghlkvtgvnagrlgialldtdgssllkpgtshnkgqgekvtgnslelpfgay vvatpealrtksvvpgdyeatatfeltyr
Timeline for d1pdkb_: