Lineage for d4kdyb2 (4kdy B:86-213)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1271284Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1271285Protein automated matches [226831] (36 species)
    not a true protein
  7. 1271297Species Anaeromyxobacter dehalogenans [TaxId:455488] [226577] (3 PDB entries)
  8. 1271303Domain d4kdyb2: 4kdy B:86-213 [224259]
    Other proteins in same PDB: d4kdya1, d4kdyb1
    automated match to d1e6ba1
    complexed with cit, gol, gsh

Details for d4kdyb2

PDB Entry: 4kdy (more details), 1.5 Å

PDB Description: crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
PDB Compounds: (B:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4kdyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdyb2 a.45.1.0 (B:86-213) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
allppdlwgrarvralaehvnsgtqpmqnalvlrmlrekvpgwdrewarffiarglaale
tavrdgagrfshgdaptladcylvpqlynarrfgldlepyptlrrvdeacaalapfqaah
pdrqpdap

SCOPe Domain Coordinates for d4kdyb2:

Click to download the PDB-style file with coordinates for d4kdyb2.
(The format of our PDB-style files is described here.)

Timeline for d4kdyb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4kdyb1