| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Anaeromyxobacter dehalogenans [TaxId:455488] [226577] (3 PDB entries) |
| Domain d4kdya2: 4kdy A:86-220 [224257] Other proteins in same PDB: d4kdya1, d4kdya3, d4kdyb1, d4kdyb3 automated match to d1e6ba1 complexed with cit, gol, gsh |
PDB Entry: 4kdy (more details), 1.5 Å
SCOPe Domain Sequences for d4kdya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kdya2 a.45.1.0 (A:86-220) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
allppdlwgrarvralaehvnsgtqpmqnalvlrmlrekvpgwdrewarffiarglaale
tavrdgagrfshgdaptladcylvpqlynarrfgldlepyptlrrvdeacaalapfqaah
pdrqpdapppdrrtp
Timeline for d4kdya2: