Lineage for d4kdya2 (4kdy A:86-220)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2322778Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2322779Protein automated matches [226831] (65 species)
    not a true protein
  7. 2322791Species Anaeromyxobacter dehalogenans [TaxId:455488] [226577] (3 PDB entries)
  8. 2322796Domain d4kdya2: 4kdy A:86-220 [224257]
    Other proteins in same PDB: d4kdya1, d4kdya3, d4kdyb1, d4kdyb3
    automated match to d1e6ba1
    complexed with cit, gol, gsh

Details for d4kdya2

PDB Entry: 4kdy (more details), 1.5 Å

PDB Description: crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
PDB Compounds: (A:) Maleylacetoacetate isomerase

SCOPe Domain Sequences for d4kdya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdya2 a.45.1.0 (A:86-220) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]}
allppdlwgrarvralaehvnsgtqpmqnalvlrmlrekvpgwdrewarffiarglaale
tavrdgagrfshgdaptladcylvpqlynarrfgldlepyptlrrvdeacaalapfqaah
pdrqpdapppdrrtp

SCOPe Domain Coordinates for d4kdya2:

Click to download the PDB-style file with coordinates for d4kdya2.
(The format of our PDB-style files is described here.)

Timeline for d4kdya2: