Lineage for d4kdtd_ (4kdt D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2025134Protein beta2-microglobulin [88600] (6 species)
  7. 2025149Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries)
    Uniprot P61769 21-119 ! Uniprot P01884
  8. 2025742Domain d4kdtd_: 4kdt D: [224255]
    automated match to d2yxfa_
    complexed with gol, so4

Details for d4kdtd_

PDB Entry: 4kdt (more details), 2.6 Å

PDB Description: structure of an early native-like intermediate of beta2-microglobulin amyloidosis
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d4kdtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdtd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
rtpkiqvysrhpaengksnflncyvsgfhgsdievdllkngeriekvehsdlsfskdwsf
yllyyteftptekdeyacrvnhvtlsqpkivkwdr

SCOPe Domain Coordinates for d4kdtd_:

Click to download the PDB-style file with coordinates for d4kdtd_.
(The format of our PDB-style files is described here.)

Timeline for d4kdtd_: